missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BID (Human) Recombinant Protein

Human BID full-length ORF ( AAH09197, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.

359.00€ - 545.00€

Spécification

Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Identification génétique (Entrez) 637
Consulter d'autres spécifications

Produits 2
Code produit Marque Quantité Prix Quantité et disponibilité  
Code produit Marque Quantité Prix Quantité et disponibilité  
16142241
Afficher les documents Détails de la promotion
Abnova™
H00000637-P01.10UG
10 μg
359.00€
10µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 19-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
16152241
Afficher les documents Détails de la promotion
Abnova™
H00000637-P01.25UG
25 μg
545.00€
25µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 19-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
Description

Description

  • Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Spécification

Spécification

Store at -80°C. Aliquot to avoid repeated freezing and thawing.
637
FDS
Product Certifications