Abnova™ CDKN2C Recombinant Protein

Name: Abnova&trade; CDKN2C Recombinant Protein
Brand: Abnova&trade;
SKU: 16133071
Price: 508.00 EUR

Marque: Abnova™ H00001031-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

Code produit. 16133071

Expédition estimée: 07-06-2024
pour voir le stock disponible

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Numéro d’adhésion	AAH16173
Formule	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Poids moléculaire	44.6
Plage de pH	8
Méthode de purification	Glutathione Sepharose 4 Fast Flow
Quantité	25 ug
Immunogène	MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHMASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Alias de gène	INK4C/p18/p18-INK4C
Symbole de gène(s)	CDKN2C
Espèces	Wheat Germ (in vitro)
Marqueur de protéine	GST

À utiliser avec (application)	Antibody Production, Protein Array, ELISA, Western Blot
Identification génétique (Entrez)	1031
Nom	CDKN2C (Human) Recombinant Protein (P01)
Méthode de préparation	In vitro wheat germ expression system
Test du contrôle qualité	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nom usuel	CDKN2C
Réactivité croisée	Human
Recombinant	Recombinant
Forme	Solution

Suggestions de produits

Description