missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ DEFA1 (Human) Recombinant Protein
Human DEFA1 full-length ORF ( AAH27917, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
Marque: Abnova™ H00001667-P01.25ug
Informations supplémentaires : Poids : 0.00010kg
Description
- Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Spécification
| AAH27917 | |
| defensin, alpha 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DEFA1 | |
| GST |
| 1667 | |
| Wheat germ expression system | |
| 25 μg | |
| DEF1, DEFA2, HNP-1, HP-1, MGC138393, MRS | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |