Abnova™ HBG1 Recombinant Protein

Name: Abnova&trade; HBG1 Recombinant Protein
Brand: Abnova&trade;
SKU: 16106021
Price: 508.00 EUR

Marque: Abnova™ H00003047-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

Code produit. 16106021

Expédition estimée: 31-05-2024
pour voir le stock disponible

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Numéro d’adhésion	AAH10913
Formule	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Poids moléculaire	41.9
Plage de pH	8
Méthode de purification	Glutathione Sepharose 4 Fast Flow
Quantité	25 ug
Immunogène	MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAVMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Alias de gène	HBGA/HBGR/HSGGL1/PRO2979
Symbole de gène(s)	HBG1
Espèces	Wheat Germ (in vitro)
Marqueur de protéine	GST

À utiliser avec (application)	Antibody Production, Protein Array, ELISA, Western Blot
Identification génétique (Entrez)	3047
Nom	HBG1 (Human) Recombinant Protein (P01)
Méthode de préparation	In vitro wheat germ expression system
Test du contrôle qualité	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nom usuel	HBG1
Réactivité croisée	Human
Recombinant	Recombinant
Forme	Solution

Suggestions de produits

Description