Learn More
Abnova™ Human ABCF1 Partial ORF (NP_001081, 642 a.a. - 739 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. [provided by RefSeq]
Spécification
Spécification
| Numéro d’adhésion | NP_001081 |
| À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Identification génétique (Entrez) | 23 |
| Poids moléculaire | 36.52kDa |
| Nom | ABCF1 (Human) Recombinant Protein (Q01) |
| Test du contrôle qualité | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantité | 25 μg |
| Immunogène | GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES |
| Conditions de stockage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Afficher plus |
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.