missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human ADAP (aa 19-145) Control Fragment Recombinant Protein Code produit.: 30202238
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30202238

Invitrogen™ Human ADAP (aa 19-145) Control Fragment Recombinant Protein

Code produit. 30202238
100 μl, 100µL
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30202238

Marque: Invitrogen™ RP102114

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82934 (PA5-82934. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The adhesion and degranulation adaptor protein (ADAP) was initially identified as a molecular adapter that couples T cell receptor (TCR) stimulation to the avidity of integrins governing T cell adhesion. TCR stimulation promotes the formation of a multi-protein complex containing CARMA1, MALT1, and BCL-10, which through the association of ADAP, ultimately activates the NF-kappa-B family of transcription factors. More recent experiments have shown that ADAP controls optimal T cell proliferation, cytokine production, and expression of the Bcl-2 family member Bcl-x(L), suggesting that ADAP regulates T cell activation by promoting antigen-dependent T cell-antigen presenting cell (APC) activation. At least three isoforms of ADAP are known to exist.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion O15117
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 2533
Nom Human ADAP (aa 19-145) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène ADAP; adhesion and degranulation promoting adaptor protein; adhesion and degranulation-promoting adaptor protein; B630013F22Rik; Fyb; Fyb1; FYB-120/130; FYN binding protein; FYN binding protein (FYB-120/130); FYN binding protein FYB-130; FYN-binding protein; FYN-binding protein 1; FYN-T-binding protein; p120/130; p120/p130; PRO0823; RGD1563421; Slap130; SLAP-130; SLP-76-associated phosphoprotein
Nom usuel ADAP
Symbole de gène(s) FYB1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence RPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSSEEKPDKEPKPPFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINLPKEDSKPTFPWPPGNKPSLHSVNQD
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Invitrogen™ Human ADAP (aa 19-145) Control Fragment Recombinant Protein >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis