missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human BCS1L Partial ORF (NP_004319, 320 a.a. - 418 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Spécification
Numéro d’adhésion | NP_004319 |
---|---|
À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Identification génétique (Entrez) | 617 |
Poids moléculaire | 36.63kDa |
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
---|---|---|---|---|---|---|---|---|---|
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
16105194
|
Abnova™
H00000617-Q01.25UG |
25 ug |
508.00€
25µg |
Expédition estimée: 19-06-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
16195184
|
Abnova™
H00000617-Q01.10UG |
10 ug |
335.00€
10µg |
Expédition estimée: 19-06-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Description
This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Two alternatively spliced transcripts encoding the same protein have been described. [provided by RefSeq]
Sequence: ASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLRSpécification
NP_004319 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
BCS/BCS1/BJS/FLNMS/GRACILE/Hs.6719/PTD/h-BCS | |
BCS1L | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
617 | |
BCS1L (Human) Recombinant Protein (Q01) | |
ASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLR | |
RUO | |
BCS1L | |
Wheat Germ (in vitro) | |
GST | |
Liquid |