missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human Bisphosphoglycerate mutase (aa 13-112) Control Fragment Recombinant Protein Code produit.: 30197645
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30197645

Invitrogen™ Human Bisphosphoglycerate mutase (aa 13-112) Control Fragment Recombinant Protein

Code produit. 30197645
100 μl, 100µL
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30197645

Marque: Invitrogen™ RP90909

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83029 (PA5-83029. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Riboflavin kinase is an essential enzyme that catalyzes the phosphorylation of riboflavin to form flavin mononucleotide, an obligatory step in vitamin B2 utilization and flavin cofactor synthesis.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P07738
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 669
Nom Human Bisphosphoglycerate mutase (aa 13-112) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 2,3-bisphosphoglycerate mutase; 2,3-bisphosphoglycerate mutase, erythrocyte; 2,3-bisphosphoglycerate synthase; 2,3-diphosphoglycerate mutase; Ab2-098; AI323730; AL022789; Bisphosphoglycerate mutase; BPG-dependent PGAM; Bpgm; C86192; DPGM; erythrocyte 2,3-bisphosphoglycerate mutase; hypothetical protein LOC533785; testis secretory sperm-binding protein Li 202 A; zgc:92230
Nom usuel Bisphosphoglycerate mutase
Symbole de gène(s) BPGM
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence EGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQV
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Invitrogen™ Human Bisphosphoglycerate mutase (aa 13-112) Control Fragment Recombinant Protein >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis