Learn More
Abnova™ Human C10orf48 Partial ORF (NP_775847, 1 a.a. - 95 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00283078-Q01.10ug
Informations supplémentaires : Poids : 0.00010kg
Description
MKX is a member of an Iroquois (IRX) family-related class of 'three-amino acid loop extension' (TALE) atypical homeobox proteins characterized by 3 additional amino acids in the loop region between helix I and helix II of the homeodomain (Anderson et al., 2006 [PubMed 16408284]).[supplied by OMIM]
Sequence: MNTIVFNKLSSAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDNSpécification
NP_775847 | |
Liquid | |
283078 | |
C10orf48 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
C10orf48/IFRX/IRXL1/MGC39616 | |
MKX | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.19kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MNTIVFNKLSSAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDN | |
RUO | |
MKX | |
Wheat Germ (in vitro) | |
GST |