Learn More
Abnova™ Human CDKN1A Partial ORF (AAH00312.1, 65 a.a. - 164 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00001026-Q01.25ug
Informations supplémentaires : Poids : 0.00010kg
Description
This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-CDK2 or -CDK4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen (PCNA), a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of CDK2, and may be instrumental in the execution of apoptosis following caspase activation. Two alternatively spliced variants, which encode an identical protein, have been reported. [provided by RefSeq]
Sequence: WERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKPSpécification
AAH00312.1 | |
Liquid | |
1026 | |
CDKN1A (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CAP20/CDKN1/CIP1/MDA-6/P21/SDI1/WAF1/p21CIP1 | |
CDKN1A | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
WERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP | |
RUO | |
CDKN1A | |
Wheat Germ (in vitro) | |
GST |