missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CETN1 Partial ORF (AAH29515.1, 16 a.a. - 94 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00001068-Q02.25ug

Informations supplémentaires : Poids : 0.02000kg

 Afficher plus de versions de ce produit

Code produit. 16003835

  • 545.00€ / 25µg
Expédition estimée: 09-08-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq]

Sequence: KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMT
Spécification

Spécification

AAH29515.1
Liquid
1068
CETN1 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CEN1/CETN
CETN1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.32kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMT
RUO
CETN1
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions