missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CHST12 Partial ORF (NP_061111.1, 56 a.a. - 150 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00055501-Q02.10ug

Informations supplémentaires : Poids : 0.02000kg

 Afficher plus de versions de ce produit

Code produit. 16015565

  • 359.00€ / 10µg
Expédition estimée: 09-08-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Chondroitin 4-sulfotransferases, such as CHST12, add sulfate to position 4 of N-acetylgalactosamine residues in chondroitin (Hiraoka et al., 2000 [PubMed 10781601]).[supplied by OMIM]

Sequence: RDRELTADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIP
Spécification

Spécification

NP_061111.1
Liquid
55501
CHST12 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C4S-2/C4ST-2/C4ST2
CHST12
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.19kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RDRELTADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIP
RUO
CHST12
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions