missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DAND5 Partial ORF (NP_689867, 90 a.a. - 188 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Spécification
| Numéro d’adhésion | NP_689867 |
|---|---|
| À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Identification génétique (Entrez) | 199699 |
| Poids moléculaire | 36.63kDa |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
16162367
|
Abnova™
H00199699-Q01.25UG |
25 ug |
508.00€
25µg |
Expédition estimée: 29-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
|
16152367
|
Abnova™
H00199699-Q01.10UG |
10 ug |
335.00€
10µg |
Expédition estimée: 29-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Description
This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to bind Nodal and to inhibit the Nodal signaling pathway which patterns left/right body asymmetry. [provided by RefSeq]
Sequence: PLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKSpécification
| NP_689867 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CER2/CERL2/CKTSF1B3/COCO/CRL2/DANTE/GREM3/MGC126849/SP1 | |
| DAND5 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 199699 | |
| DAND5 (Human) Recombinant Protein (Q01) | |
| PLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPK | |
| RUO | |
| DAND5 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |