missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DAND5 Partial ORF (NP_689867, 90 a.a. - 188 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

359.00€ - 545.00€

Spécification

Nom DAND5 (Human) Recombinant Protein (Q01)
Recombinant Yes
À utiliser avec (application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Poids moléculaire 36.63kDa
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Consulter d'autres spécifications

Produits 2
Code produit Marque Quantité Prix Quantité et disponibilité  
Code produit Marque Quantité Prix Quantité et disponibilité  
16162367
Afficher les documents Détails de la promotion
Abnova™
H00199699-Q01.25UG
25 ug
545.00€
25µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 22-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
16152367
Afficher les documents Détails de la promotion
Abnova™
H00199699-Q01.10UG
10 ug
359.00€
10µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 22-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
Description

Description

This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to bind Nodal and to inhibit the Nodal signaling pathway which patterns left/right body asymmetry. [provided by RefSeq]

Sequence: PLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPK
Spécification

Spécification

DAND5 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.63kDa
FDS
Product Certifications