missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DGUOK Partial ORF (NP_001920, 1 a.a. - 89 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00001716-Q01.10ug
Informations supplémentaires : Poids : 0.00010kg
Description
In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by two deoxyribonucleoside kinases, cytosolic deoxycytidine kinase and mitochondrial deoxyguanosine kinase. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside analogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the analogs. Alternative splice variants encoding different protein isoforms have been described for this gene. [provided by RefSeq]
Sequence: MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIGLHCPKSWKLAGYDVPGASTMVLHIPDIFLFEPPESTAGALPSpécification
| NP_001920 | |
| Liquid | |
| 1716 | |
| DGUOK (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| dGK | |
| DGUOK | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.53kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIGLHCPKSWKLAGYDVPGASTMVLHIPDIFLFEPPESTAGALP | |
| RUO | |
| DGUOK | |
| Wheat Germ (in vitro) | |
| GST |