missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EBI3 Partial ORF (NP_005746, 129 a.a. - 229 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

359.00€ - 545.00€

Spécification

Nom EBI3 (Human) Recombinant Protein (Q01)
Recombinant Yes
À utiliser avec (application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Poids moléculaire 36.63kDa
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Consulter d'autres spécifications

Produits 2
Code produit Marque Quantité Prix Quantité et disponibilité  
Code produit Marque Quantité Prix Quantité et disponibilité  
16161986
Afficher les documents Détails de la promotion
Abnova™
H00010148-Q01.25UG
25 ug
545.00€
25µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 22-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
16151986
Afficher les documents Détails de la promotion
Abnova™
H00010148-Q01.10UG
10 ug
359.00€
10µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 22-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
Description

Description

This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq]

Sequence: PDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Spécification

Spécification

EBI3 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.63kDa
FDS
Product Certifications