missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FASLG Partial ORF (AAH17502.1, 172 a.a. - 281 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00000356-Q01.10ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16151751

  • 359.00€ / 10µg
Expédition estimée: 19-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). [provided by RefSeq]

Sequence: SGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Spécification

Spécification

AAH17502.1
Liquid
356
FASLG (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
APT1LG1/CD178/CD95L/FASL/TNFSF6
FASLG
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
RUO
FASLG
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions