Learn More
Abnova™ Human KCNE2 Partial ORF (NP_751951, 73 a.a. - 123 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq]
Spécification
Spécification
| Numéro d’adhésion | NP_751951 |
| À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Identification génétique (Entrez) | 9992 |
| Poids moléculaire | 31.35kDa |
| Nom | KCNE2 (Human) Recombinant Protein (Q01) |
| Test du contrôle qualité | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantité | 10 μg |
| Immunogène | KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP |
| Conditions de stockage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Afficher plus |
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.