Learn More
Abnova™ Human KLF9 Partial ORF (NP_001197, 25 a.a. - 101 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00000687-Q01.25ug
Informations supplémentaires : Poids : 0.00010kg
Description
The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription. [provided by RefSeq]
Sequence: PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTSpécification
NP_001197 | |
Liquid | |
687 | |
KLF9 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
BTEB/BTEB1 | |
KLF9 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.21kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTT | |
RUO | |
KLF9 | |
Wheat Germ (in vitro) | |
GST |