missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NDUFA8 Partial ORF (NP_055037.1, 1 a.a. - 72 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00004702-Q01.10ug

Informations supplémentaires : Poids : 0.02000kg

 Afficher plus de versions de ce produit

Code produit. 16004445

  • 359.00€ / 10µg
Expédition estimée: 24-08-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

The protein encoded by this gene belongs to the complex I 19 kDA subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Sequence: MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR
Spécification

Spécification

NP_055037.1
Liquid
4702
NDUFA8 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CI-19KD/CI-PGIV/MGC793/PGIV
NDUFA8
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.66kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR
RUO
NDUFA8
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions