Learn More
Abnova™ Human PDCD6IP Partial ORF (AAH20066, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
This gene encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Spécification
Spécification
| Numéro d’adhésion | AAH20066 |
| À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Identification génétique (Entrez) | 10015 |
| Poids moléculaire | 37.73kDa |
| Nom | PDCD6IP (Human) Recombinant Protein (Q01) |
| Test du contrôle qualité | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantité | 10 μg |
| Immunogène | MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVK |
| Conditions de stockage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Afficher plus |
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.