missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PGK2 Partial ORF (NP_620061, 268 a.a. - 339 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Spécification
Numéro d’adhésion | NP_620061 |
---|---|
À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Identification génétique (Entrez) | 5232 |
Poids moléculaire | 33.66kDa |
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
---|---|---|---|---|---|---|---|---|---|
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
16152705
|
Abnova™
H00005232-Q01L |
25 ug |
508.00€
25µg |
Expédition estimée: 18-06-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
16142705
|
Abnova™
H00005232-Q01S |
10 ug |
335.00€
10µg |
Expédition estimée: 18-06-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Description
The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. See also PGK1 (MIM 311800), which is ubiquitously expressed in all somatic tissues and maps to chromosome Xq13.[supplied by OMIM]
Sequence: DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPSpecifications
NP_620061 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.66kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
PGK-2/PGKB/PGKPS/dJ417L20.2 | |
PGK2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
5232 | |
PGK2 (Human) Recombinant Protein (Q01) | |
DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP | |
RUO | |
PGK2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |