Abnova™ Human PODN Partial ORF (NP_714914.2, 541 a.a. - 644 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque: Abnova™ H00127435-Q01.25ug

Code produit. 16161737

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Sequence: GPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLEYLYLQNNKISAVPANAFDSTPNLKGIFLRFNKLAVGSVVDSAFRRLKHLQVLDIEGNLEFGDISKDRGRLG

Spécification

Numéro d’adhésion	NP_714914.2
Formule	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Poids moléculaire	37.18kDa
Test du contrôle qualité	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogène	GPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLEYLYLQNNKISAVPANAFDSTPNLKGIFLRFNKLAVGSVVDSAFRRLKHLQVLDIEGNLEFGDISKDRGRLG
État réglementaire	RUO
Nom usuel	PODN
Espèces	Wheat Germ (in vitro)
Marqueur de protéine	GST
Forme	Liquid

À utiliser avec (application)	Antibody Production, ELISA, Protein Array, Western Blot
Identification génétique (Entrez)	127435
Nom	PODN (Human) Recombinant Protein (Q01)
Quantité	25 ug
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène	MGC24995/PCAN/SLRR5A
Symbole de gène(s)	PODN
Recombinant	Recombinant
Système d’expression	wheat germ expression system

Suggestions de produits

Description