missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRKCD Partial ORF (NP_006245, 577 a.a. - 676 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

359.00€ - 545.00€

Spécification

Nom PRKCD (Human) Recombinant Protein (Q02)
Recombinant Yes
À utiliser avec (application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Poids moléculaire 36.74kDa
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Consulter d'autres spécifications

Produits 2
Code produit Marque Quantité Prix Quantité et disponibilité  
Code produit Marque Quantité Prix Quantité et disponibilité  
16094565
Afficher les documents Détails de la promotion
Abnova™
H00005580-Q02.10UG
10 ug
359.00€
10µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 10-10-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
16004575
Afficher les documents Détails de la promotion
Abnova™
H00005580-Q02.25UG
25 ug
545.00€
25µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 10-10-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
Description

Description

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]

Sequence: DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Spécification

Spécification

PRKCD (Human) Recombinant Protein (Q02)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.74kDa
FDS
Product Certifications