missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RAD51L1 Full-length ORF (NP_598193.2, 1 a.a. - 384 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

359.00€ - 545.00€

Spécification

Nom RAD51L1 (Human) Recombinant Protein (P01)
Recombinant Yes
Méthode de purification Glutathione Sepharose 4 Fast Flow
À utiliser avec (application) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Poids moléculaire 68.6kDa
Consulter d'autres spécifications

Produits 2
Code produit Marque Quantité Prix Quantité et disponibilité  
Code produit Marque Quantité Prix Quantité et disponibilité  
16142118
Afficher les documents Détails de la promotion
Abnova™
H00005890-P01.10UG
10 ug
359.00€
10µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 23-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
16152118
Afficher les documents Détails de la promotion
Abnova™
H00005890-P01.25UG
25 ug
545.00€
25µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 23-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
Description

Description

The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Sequence: MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF
Spécification

Spécification

RAD51L1 (Human) Recombinant Protein (P01)
Glutathione Sepharose 4 Fast Flow
68.6kDa
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FDS
Product Certifications