Abnova™ Human RPRM Full-length ORF (NP_062819.1, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human RPRM Full-length ORF (NP_062819.1, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7101344

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Spécification

Numéro d’adhésion	NP_062819.1
À utiliser avec (application)	Antibody Production, Protein Array, ELISA, Western Blot
Formule	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Identification génétique (Entrez)	56475
Poids moléculaire	38.2kDa

Consulter d'autres spécifications

Prodotti 2

Codice del prodotto	Marca	Quantité	Prezzo	Quantità e disponibilità
Codice del prodotto	Marca	Quantité	Prezzo	Quantità e disponibilità
16162203 missing translation for 'viewDocuments' Dettagli della promozione missing translation for 'viewProductCertificates'	Abnova™ H00056475-P01.25UG	25 ug	508.00€ 25µg Visualizzare prodotti alternativi missing translation for 'toSaveUpto' »	Expédition estimée: 31-05-2024 Connectez-vous pour voir le stock disponible	Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

16152203 missing translation for 'viewDocuments' Dettagli della promozione missing translation for 'viewProductCertificates'	Abnova™ H00056475-P01.10UG	10 ug	335.00€ 10µg Visualizzare prodotti alternativi missing translation for 'toSaveUpto' »	Expédition estimée: 31-05-2024 Connectez-vous pour voir le stock disponible	Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Descrizione

Sequence: MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Specifica

Numéro d’adhésion	NP_062819.1
Formule	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Poids moléculaire	38.2kDa
Méthode de purification	Glutathione Sepharose 4 Fast Flow
Immunogène	MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
État réglementaire	RUO
Nom usuel	RPRM
Espèces	Wheat Germ (in vitro)
Marqueur de protéine	GST
Forme	Liquid

À utiliser avec (application)	Antibody Production, Protein Array, ELISA, Western Blot
Identification génétique (Entrez)	56475
Nom	RPRM (Human) Recombinant Protein (P01)
Test du contrôle qualité	12.5% SDS-PAGE Stained with Coomassie Blue.
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène	FLJ90327/REPRIMO
Symbole de gène(s)	RPRM
Recombinant	Recombinant
Système d’expression	wheat germ expression system

Torna in alto

Abnova™ Human RPRM Full-length ORF (NP_062819.1, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal

Spécification

Descrizione

Specifica

Documenti