Learn More
Abnova™ Human SH3BP2 Partial ORF (AAH22996, 452 a.a. - 561 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Spécification
Numéro d’adhésion | AAH22996 |
---|---|
À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Identification génétique (Entrez) | 6452 |
Poids moléculaire | 37.73kDa |
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
---|---|---|---|---|---|---|---|---|---|
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
16125205
|
Abnova™
H00006452-Q01.25UG |
25 ug |
508.00€
25µg |
Expédition estimée: 04-07-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
16115205
|
Abnova™
H00006452-Q01.10UG |
10 ug |
335.00€
10µg |
Expédition estimée: 04-07-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Description
The protein encoded by this gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases , and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: PLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPRSpécification
AAH22996 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.73kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
3BP2/CRBM/CRPM/FLJ42079/RES4-23 | |
SH3BP2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
6452 | |
SH3BP2 (Human) Recombinant Protein (Q01) | |
PLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR | |
RUO | |
SH3BP2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |