Learn More
Abnova™ Human SLC11A1 Partial ORF (NP_000569.2, 308 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Spécification
Numéro d’adhésion | NP_000569.2 |
---|---|
À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Identification génétique (Entrez) | 6556 |
Poids moléculaire | 30.47kDa |
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
---|---|---|---|---|---|---|---|---|---|
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
16115425
|
Abnova™
H00006556-Q01.10UG |
10 ug |
335.00€
10µg |
Expédition estimée: 18-06-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
16125425
|
Abnova™
H00006556-Q01.25UG |
25 ug |
508.00€
25µg |
Expédition estimée: 18-06-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Description
This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq]
Sequence: QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGVSpécification
NP_000569.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
30.47kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
LSH/NRAMP/NRAMP1 | |
SLC11A1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
6556 | |
SLC11A1 (Human) Recombinant Protein (Q01) | |
QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV | |
RUO | |
SLC11A1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |