missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SMARCD2 Partial ORF (NP_003068, 398 a.a. - 474 a.a.) Recombinant Protein with GST-tag at N-terminal
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
10 ug
25 ug
Conditionnement:
10µg
25µg
Description
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Spécification
Spécification
| Numéro d’adhésion | NP_003068 |
| À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Identification génétique (Entrez) | 6603 |
| Poids moléculaire | 34.21kDa |
| Nom | SMARCD2 (Human) Recombinant Protein (Q01) |
| Test du contrôle qualité | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantité | 25 ug |
| Immunogène | RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL |
| Conditions de stockage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Afficher plus |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Abnova™ Human SMARCD2 Partial ORF (NP_003068, 398 a.a. - 474 a.a.) Recombinant Protein with GST-tag at N-terminal >
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu