missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human SSBP4 Partial ORF (NP_116016, 135 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal Code produit.: 16152317
  1. Home
  2. Products
  3. Protéines recombinantes
  4. Abnova™ Human SSBP4 Partial ORF (NP_116016, 135 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human SSBP4 Partial ORF (NP_116016, 135 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal

Code produit. 16152317
25 μg, 25µg
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
10 μg
25 μg
Conditionnement:
10µg
25µg
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Code produit. 16152317

Marque: Abnova™ H00170463Q01.25ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Cet article est supprimé, vous trouverez le remplacement et les alternatives dans les onglets respectifs ci-dessous s'ils ont été identifiés
 Voir les produits de remplacement

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Used for AP, Array, ELISA, WB-Re

Sequence: PNAPMMGPHGQPFMSPRFPGGPRPTLRMPSQPPAGLPGSQPLLPGAMEPSPRAQGHPSMGGPMQRVTPPRGMASVGPQSYGGGMRPPPNSLAGPGLPAMNMGPGVRGPWA

Spezifikation

Numéro d’adhésion NP_116016
À utiliser avec (application) Antibody Production, ELISA, Protein Array, Western Blot
Formule 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Identification génétique (Entrez) 170463
Poids moléculaire 37.84kDa
Nom SSBP4 (Human) Recombinant Protein (Q01)
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 25 μg
Immunogène PNAPMMGPHGQPFMSPRFPGGPRPTLRMPSQPPAGLPGSQPLLPGAMEPSPRAQGHPSMGGPMQRVTPPRGMASVGPQSYGGGMRPPPNSLAGPGLPAMNMGPGVRGPWA
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
État réglementaire RUO
Alias de gène MGC3181
Nom usuel SSBP4
Symbole de gène(s) SSBP4
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Système d’expression wheat germ expression system
Forme Liquid
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human SSBP4 Partial ORF (NP_116016, 135 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt