Learn More
Abnova™ Human SUOX Partial ORF (NP_000447, 391 a.a. - 486 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00006821-Q01.10ug
Informations supplémentaires : Poids : 0.00010kg
Description
Sulfite oxidase is a homodimeric protein localized to the intermembrane space of mitochondria. Each subunit contains a heme domain and a molybdopterin-binding domain. The enzyme catalyzes the oxidation of sulfite to sulfate, the final reaction in the oxidative degradation of the sulfur amino acids cysteine and methionine. Sulfite oxidase deficiency results in neurological abnormalities which are often fatal at an early age. Alternative splicing results in multiple transcript variants encoding identical proteins. [provided by RefSeq]
Sequence: YAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSpécification
NP_000447 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.3kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
YAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYV | |
RUO | |
SUOX | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
6821 | |
SUOX (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
SUOX | |
Wheat Germ (in vitro) | |
GST | |
Liquid |