missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human Syncollin Control Fragment Recombinant Protein Code produit.: 30181514
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30181514

Invitrogen™ Human Syncollin Control Fragment Recombinant Protein

Code produit. 30181514
100 μl, 100µL
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30181514

Marque: Invitrogen™ RP99213

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61563 (PA5-61563. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Syncollin is a 134 amino acid, small peripheral membrane protein abundantly expressed in pancreatic acinar cells and is tightly associated with the lumenal side of the zymogen granule membrane. It contains intrachain disulfide bonds. Syncollin is also known to associate with lipid rafts in a cholesterol-dependent manner. In pancreatic acinar cells, syncollin helps in exocytosis and also plays a role in maturation and/or concentration of zymogens in zymogen granules. Reports suggest that syncollin may also have a pore-forming activity on membranes and regulate exocytosis insome exocrine tissues.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q0VAF6
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 342898
Nom Human Syncollin Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 0910001K16Rik; 1810038B08Rik; FLJ27441; INSSA1; insulin synthesis associated 1; insulin synthesis-associated protein 1; Proximal small intestine-specific protein 9; Sip9; Sycn; SYL; syncollin
Nom usuel Syncollin
Symbole de gène(s) SYCN
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence TASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCP
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human Syncollin Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.