Learn More
Abnova™ Human TNP1 Partial ORF (NP_003275.1, 1 a.a. - 55 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00007141-Q01.10ug
Informations supplémentaires : Poids : 0.00010kg
Description
Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by OMIM]
Sequence: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHLSpécification
NP_003275.1 | |
Liquid | |
7141 | |
TNP1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
TP1 | |
TNP1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.79kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL | |
RUO | |
TNP1 | |
Wheat Germ (in vitro) | |
GST |