Learn More
Abnova™ Human TOB1 Full-length ORF (NP_005740.1, 1 a.a. - 345 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
This gene encodes a member of the tob/btg1 family of anti-proliferative proteins that have the potential to regulate cell growth. When exogenously expressed, this protein supresses cell growth in tissue culture. The protein undergoes phophorylation by a serine/threonine kinase, 90 kDa ribosomal S6 kinase. Interactions of this protein with the v-erb-b2 erythroblastic leukemia viral oncogene homolog 2 gene product p185 interferes with growth suppression. This protein inhibits T cell proliferation and transcription of cytokines and cyclins. The protein interacts with both mothers against decapentaplegic Drosophila homolog 2 and 4 to enhance their DNA binding activity. This interaction inhibits interleukin 2 transcription in T cells. [provided by RefSeq]
Spécification
Spécification
Numéro d’adhésion | NP_005740.1 |
À utiliser avec (application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Identification génétique (Entrez) | 10140 |
Poids moléculaire | 64.6kDa |
Nom | TOB1 (Human) Recombinant Protein (P01) |
Méthode de purification | Glutathione Sepharose 4 Fast Flow |
Test du contrôle qualité | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quantité | 10 μg |
Immunogène | MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN |
Afficher plus |
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.