missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRPC6 (aa 549-587) Control Fragment Recombinant Protein

Code produit. 30200724
100 μl, 100µL
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30200724

Marque: Invitrogen™ RP107139

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Trpc6 forms a receptor-activated calcium channel in the cell membrane. The Trpc6 channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of the Trpc6 channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in the Trpc6 gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2). Further, Trpc6 is a member of the mammalian transient receptor potential (TRP) superfamily can be divided into three major families including the 'canonical TRP' (TRPC) family. The seven members of this family share the activation through PLC-coupled receptors and have been suggested to be components of receptor-regulated cation channels in different cell types. Furthermore, the members of the TRPC6/6/7 subfamily can be activated by diacylglycerol (DAG) analogs, suggesting a possible mechanism of activation of these channels by PLC-coupled receptors. When expressed in transfected cells, Trpc6 acts as a non-selective store-independent receptor-activated cation channel. Trpc6 is activated by DAG in a PKC-independent manner and is insensitive to IP3 activation. There is increasing evidence that Trpc6 encodes endogenous DAG-activated receptor-operated cation channels in vivo. Diseases associated with TRPC6 include Glomerulosclerosis, Focal Segmental, 2 and Focal Segmental Glomerulosclerosis.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9Y210
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 7225
Nom Human TRPC6 (aa 549-587) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène AV025995; bZ1P14.9; calcium entry channel; FLJ11098; FLJ14863; focal segmental glomerulosclerosis 2; FSGS2; HGNC:12338; LLHWJM002; LLHWJM003; LLHWJM004; mtrp6; Short transient receptor potential channel 6; short transient receptor potential channel 6; short transient receptor potential channel 6 A; si:rp71-1p14.9; transient receptor potential cation channel subfamily C member 6; transient receptor potential cation channel subfamily c member 6 A; transient receptor potential cation channel TRPC6; transient receptor potential cation channel, subfamily C, member 6; transient receptor potential cation channel, subfamily C, member 6 A; transient receptor potential channel 6; transient receptor potential channel subfamily C member 6; transient receptor protein 6; TRP6; TRP-6; trp6A; TRPC6; trpc6a; Trrp6
Nom usuel TRPC6
Symbole de gène(s) Trpc6
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence WHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWD
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins

Certificats

Un numéro de lot est requis pour afficher les résultats sur les certificats. Pour retrouver le numéro de lot sur des commandes passées, utiliser le menu suivi de commande.

1 Réponse(s) trouvée(s)
Numéro de lot Type de certificat Date Code produit
Numéro de lot79738542 Type de certificatCertificat d’analyse Date23/10/2025 Code produitRP107139
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Invitrogen™ Human TRPC6 (aa 549-587) Control Fragment Recombinant Protein >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis