missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. Abnova™ Human VIP Full-length ORF (AAH09794.1, 1 a.a. - 169 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human VIP Full-length ORF (AAH09794.1, 1 a.a. - 169 a.a.) Recombinant Protein with GST-tag at N-terminal

Code produit. 16194028
25 μg, 25µg
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
10 μg
25 μg
Conditionnement:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 16194028

Marque: Abnova™ H00007432P02.25ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Sequence: MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK

Spécification

Numéro d’adhésion AAH09794.1
À utiliser avec (application) Antibody Production, ELISA, Protein Array, Western Blot
Formule 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Identification génétique (Entrez) 7432
Poids moléculaire 45.5kDa
Nom VIP (Human) Recombinant Protein (P02)
Méthode de purification Glutathione Sepharose 4 Fast Flow
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 25 μg
Immunogène MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
État réglementaire RUO
Alias de gène MGC13587/PHM27
Nom usuel VIP
Symbole de gène(s) VIP
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Système d’expression wheat germ expression system
Forme Liquid
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Abnova™ Human VIP Full-length ORF (AAH09794.1, 1 a.a. - 169 a.a.) Recombinant Protein with GST-tag at N-terminal >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis