Abnova™ Human ZBTB7B Partial ORF (NP_056956.1, 433 a.a. - 537 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human ZBTB7B Partial ORF (NP_056956.1, 433 a.a. - 537 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7100332

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Spécification

Numéro d’adhésion	NP_056956.1
À utiliser avec (application)	Antibody Production, Protein Array, ELISA, Western Blot
Formule	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Identification génétique (Entrez)	51043
Poids moléculaire	37.29kDa

Consulter d'autres spécifications

Produits 2

Code produit	Marque	Quantité	Prix	Quantité et disponibilité
Code produit	Marque	Quantité	Prix	Quantité et disponibilité
16136546 Afficher les documents Détails de la promotion missing translation for 'viewProductCertificates'	Abnova™ H00051043-Q01.25UG	25 ug	508.00€ 25µg Voir les produits de remplacement Économisez jusqu'à »	Expédition estimée: 24-06-2024 Connectez-vous pour voir le stock disponible	Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

16126546 Afficher les documents Détails de la promotion missing translation for 'viewProductCertificates'	Abnova™ H00051043-Q01.10UG	10 ug	335.00€ 10µg Voir les produits de remplacement Économisez jusqu'à »	Expédition estimée: 24-06-2024 Connectez-vous pour voir le stock disponible	Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Description

ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes (e.g., COL1A1; MIM 120150) and has a role in development.[supplied by OMIM]

Sequence: HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME

Spécification

Numéro d’adhésion	NP_056956.1
Formule	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Poids moléculaire	37.29kDa
Test du contrôle qualité	12.5% SDS-PAGE Stained with Coomassie Blue.
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène	DKFZp686G01254/THPOK/ZBTB15/ZFP67/ZNF857B/c-Krox/hcKrox
Symbole de gène(s)	ZBTB7B
Recombinant	Recombinant
Système d’expression	wheat germ expression system

À utiliser avec (application)	Antibody Production, Protein Array, ELISA, Western Blot
Identification génétique (Entrez)	51043
Nom	ZBTB7B (Human) Recombinant Protein (Q01)
Immunogène	HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME
État réglementaire	RUO
Nom usuel	ZBTB7B
Espèces	Wheat Germ (in vitro)
Marqueur de protéine	GST
Forme	Liquid

Abnova™ Human ZBTB7B Partial ORF (NP_056956.1, 433 a.a. - 537 a.a.) Recombinant Protein with GST-tag at N-terminal

Spécification

Description

Spécification

Documents