missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human ZFHX3 Partial ORF (NP_008816, 2811 a.a. - 2910 a.a.) Recombinant Protein with GST-tag at N-terminal Code produit.: 16161971

Abnova™ Human ZFHX3 Partial ORF (NP_008816, 2811 a.a. - 2910 a.a.) Recombinant Protein with GST-tag at N-terminal

Code produit. 16161971
25 ug, 25µg
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
10 ug
25 ug
Conditionnement:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 16161971

Marque: Abnova™ H00000463Q01.25ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Cet article est supprimé, vous trouverez le remplacement et les alternatives dans les onglets respectifs ci-dessous s'ils ont été identifiés
Voir les produits de remplacement

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Used for AP, Array, ELISA, WB-Re

This gene encodes a transcription factor with multiple homeodomains and zinc finger motifs, and regulates myogenic and neuronal differentiation. The encoded protein suppresses expression of the alpha-fetoprotein gene by binding to an AT-rich enhancer motif. The protein has also been shown to negatively regulate c-Myb, and transactivate the cell cycle inhibitor cyclin-dependent kinase inhibitor 1A (also known as p21CIP1). This gene is reported to function as a tumor suppressor in several cancers, and sequence variants of this gene are also associated with atrial fibrillation. Multiple transcript variants expressed from alternate promoters and encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG

Spécification

Numéro d’adhésion NP_008816
À utiliser avec (application) Antibody Production, Protein Array, ELISA, Western Blot
Formule 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Identification génétique (Entrez) 463
Poids moléculaire 36.74kDa
Nom ZFHX3 (Human) Recombinant Protein (Q01)
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 25 ug
Immunogène EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
État réglementaire RUO
Alias de gène ATBF1/ATBT
Nom usuel ZFHX3
Symbole de gène(s) ZFHX3
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Système d’expression wheat germ expression system
Forme Liquid
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Abnova™ Human ZFHX3 Partial ORF (NP_008816, 2811 a.a. - 2910 a.a.) Recombinant Protein with GST-tag at N-terminal >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis