missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Réactifs biochimiques
  4. Peptides
  5. 18205593

Novus Biologicals™ MICB Recombinant Protein Antigen

Code produit. 18205593 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit. Quantité unitSize
18205593 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit. 18205593 Fournisseur Novus Biologicals™ Code fournisseur NBP256506PEP

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MICB. Source: E.coli Amino Acid Sequence: CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE The MICB Recombinant Protein Antigen is derived from E. coli. The MICB Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 4277
Méthode de purification >80% by SDS-PAGE and Coomassie blue staining
Nom usuel MICB Recombinant Protein Antigen
Contenu et stockage Store at −20°C. Avoid freeze-thaw cycles.
Formule PBS and 1M Urea, pH 7.4.
À utiliser avec (application) Blocking/Neutralizing, Control
Alias de gène MHC class I chain-related protein B, MHC class I mic-B antigen, MHC class I polypeptide-related sequence B, MIC-B, PERB11.2MHC class I-like molecule PERB11.2-IMX, stress inducible class I homolog
Symbole de gène(s) MICB
Type d’étiquette Unlabeled
Type de produit Recombinant Protein Antigen
Quantité 100 μl
État réglementaire RUO
Source E.coli
Réactivité spécifique This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52790. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Afficher plus Afficher moins

Usage exclusivement réservé à la recherche.

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.