missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 16176396

DEF6, Mouse, Polyclonal Antibody, Abnova™

Code produit 16176396
Change view
Click to view available options
Quantité:
50 μg
Conditionnement:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
16176396 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16176396 Fournisseur Abnova Code fournisseur H00050619B01P

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Cet article est supprimé, vous trouverez le remplacement et les alternatives dans les onglets respectifs ci-dessous s'ils ont été identifiés
 Voir les produits de remplacement

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Mouse polyclonal antibody raised against a full-length human DEF6 protein.

DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 [PubMed 12923183]).[supplied by OMIM

Sequence: MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEEAARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTRLLEEEEEKLKQLMQLKEEQERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGGDEAPAPASTPQEDKLDPAPEN

Spécification

Antigène DEF6
Applications Western Blot
Classification Polyclonal
Conjugué Unconjugated
Description Mouse polyclonal antibody raised against a full-length human DEF6 protein.
Formule PBS with no preservative; pH 7.4
Expression DEF6
Numéro d’ordre du gène NM_022047.2
Alias de gène IBP/SLAT
Symboles de gène(s) DEF6
Espèces hôtes Mouse
Immunogène DEF6 (NP_071330.2,1 a.a. ∽ 631 a.a) full-length human protein.
Méthode de purification Affinity chromatography
Quantité 50 μg
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 50619
Espèces cibles Human
Contenu et stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.