missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Réactifs biochimiques
  4. Peptides
  5. 18171939

Novus Biologicals™ Myeloperoxidase/MPO Recombinant Protein Antigen

Code produit. 18171939 Tous les produits Bio Techne Produits
Click to view available options
Quantité:
0,1 ml
Conditionnement:
0.10mL
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18171939

missing translation for 'mfr': Novus Biologicals™ NBP238922PEP

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

220.15 EUR valable jusqu'au 2025-12-16
MEILLEUR PRIX promo! Utilisez le code promo "24090" pour bénéficier de cette offre.
Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MPO. The Myeloperoxidase/MPO Recombinant Protein Antigen is derived from E. coli. The Myeloperoxidase/MPO Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-38922. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 4353
Espèces Human
Méthode de purification Chromatography
Pureté >80%
Concentration 0.5mg/mL
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Formule PBS and 1M Urea, pH 7.4.
À utiliser avec (application) Blocking/Neutralizing, Control
Symbole de gène(s) MPO
Type d’étiquette Unlabeled
Poids moléculaire 22kDa
Type de produit Myeloperoxidase/MPO
Quantité 0,1 ml
État réglementaire RUO
Source E.Coli
Réactivité spécifique This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38922. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogène GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR
Mostrar más Mostrar menos

Usage exclusivement réservé à la recherche

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado