missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen
Tous les produits Bio Techne Produits
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NGFI-B alpha/Nur77/NR4A1. Source: E.coli Amino Acid Sequence: PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG The NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen is derived from E. coli. The NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spécification
Spécification
| Gene ID (Entrez) | 3164 |
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
| Nom usuel | NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen |
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | Early response protein NAK1, GFRP1ST-59, growth factor-inducible nuclear protein N10, HMRNP10, hormone receptor, MGC9485, N10, NAK1, NAK-1, NGFIB, Nuclear hormone receptor NUR/77, nuclear receptor subfamily 4 group A member 1, nuclear receptor subfamily 4 |
| Symbole de gène(s) | NR4A1 |
| Type d’étiquette | Unlabeled |
| Type de produit | Recombinant Protein Antigen |
| Afficher plus |
Usage exclusivement réservé à la recherche.
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu