missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. NHE3/SLC9A3 Antibody, Novus Biologicals™

NHE3/SLC9A3 Antibody, Novus Biologicals™

Code produit 18413891
Change view
Click to view available options
Quantité:
25 μL
0.1 mL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18413891 25 μL 25µL
18781644 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18413891 Fournisseur Novus Biologicals (Bio-Techne) Code fournisseur NBP18257425ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody has been used in 13 publications

NHE3/SLC9A3 Polyclonal specifically detects NHE3/SLC9A3 in Human, Mouse, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, SDS-Page.
TRUSTED_SUSTAINABILITY

Spécification

Antigène NHE3/SLC9A3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot Reported in scientific literature (PMID: 32738496). , Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID: 32502894)., Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen Reported in scientific literature (PMID 26677983), SDS-Page Reported in scientific literature (PMID: 32738496).
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène isoform 3, MGC126718, NHE3MGC126720, solute carrier family 9 (sodium/hydrogen exchanger), member 3, Solute carrier family 9 member 3
Symboles de gène(s) SLC9A3
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST
Méthode de purification Affinity Purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction
Primaire ou secondaire Primary
Identification génétique (Entrez) 6550
Spécificité du test Specificity of human NHE3/SLC9A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.