missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Réactifs biochimiques
  4. Peptides
  5. 18230583

Novus Biologicals™ POLN Recombinant Protein Antigen

Code produit. 18230583 Tous les produits Bio Techne Produits
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 18230583

Marque: Novus Biologicals™ NBP258779PEP

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLN. Source: E.coli Amino Acid Sequence: FSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRR The POLN Recombinant Protein Antigen is derived from E. coli. The POLN Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 353497
Méthode de purification >80% by SDS-PAGE and Coomassie blue staining
Nom usuel POLN Recombinant Protein Antigen
Contenu et stockage Store at −20°C. Avoid freeze-thaw cycles.
Formule PBS and 1M Urea, pH 7.4.
À utiliser avec (application) Blocking/Neutralizing, Control
Alias de gène DNA polymerase N, DNA polymerase nu, DNA polymerase POL4P, EC 2.7.7.7, POL4P, polymerase (DNA directed) nu
Symbole de gène(s) POLN
Type d’étiquette Unlabeled
Type de produit Recombinant Protein Antigen
Quantité 100 μl
État réglementaire RUO
Catégorie de recherche DNA Repair
Source E.coli
Réactivité spécifique This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51279. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Afficher plus Afficher moins

Usage exclusivement réservé à la recherche.

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis