missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ RAB8A (Human) Recombinant Protein

Human RAB8A full-length ORF ( AAH02977, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00004218-P01.10ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16151175

  • 359.00€ / 10µg
Expédition estimée: 19-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Spécification

Spécification

AAH02977
RAB8A, member RAS oncogene family
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RAB8A
GST
4218
Wheat germ expression system
10 μg
MEL, RAB8
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents
Certificats
Promotions

Promotions