missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 16004617

FBRS, Rabbit, Polyclonal Antibody, Abnova™

Code produit 16004617
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
16004617 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16004617 Fournisseur Abnova Code fournisseur PAB24061.100uL

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit polyclonal antibody raised against recombinant FBRS.

Fibrosin is a lymphokine secreted by activated lymphocytes that induces fibroblast proliferation (Prakash and Robbins, 1998 [PubMed 9809749]).[supplied by OMIM

Sequence: LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH

Spécification

Antigène FBRS
Applications Immunohistochemistry (PFA fixed), Western Blot
Classification Polyclonal
Conjugué Unconjugated
Description Rabbit polyclonal antibody raised against recombinant FBRS.
Dilution Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Formule In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Expression FBRS
Numéro d’ordre du gène Q9HAH7
Alias de gène FBS/FBS1/FLJ11618
Symboles de gène(s) FBRS
Espèces hôtes Rabbit
Immunogène Recombinant protein corresponding to amino acids of human FBRS.
Méthode de purification Antigen affinity purification
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 64319
Espèces cibles Human
Contenu et stockage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Forme Liquid
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.