missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 16143300

VAV2 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Code produit 16143300
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
16143300 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16143300 Fournisseur Abnova Code fournisseur PAB20180.100uL

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit polyclonal antibody raised against recombinant VAV2.

VAV2 is the second member of the VAV guanine nucleotide exchange factor family of oncogenes. Unlike VAV1, which is expressed exclusively in hematopoietic cells, VAV2 transcripts were found in most tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: PVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWI

Spécification

Antigène VAV2
Applications Immunohistochemistry (PFA fixed)
Classification Polyclonal
Conjugué Unconjugated
Description Rabbit polyclonal antibody raised against recombinant VAV2.
Dilution Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
Formule In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Expression VAV2
Symboles de gène(s) VAV2
Espèces hôtes Rabbit
Immunogène Recombinant protein corresponding to amino acids of human VAV2.
Méthode de purification Antigen affinity purification
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 7410
Espèces cibles Human
Contenu et stockage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Forme Liquid
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.