missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant HIV-1 Integrase Protein
A cDNA sequence encoding the HIV-1 Integrase was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP12252-1mg
Informations supplémentaires : Poids : 0.01000kg
Spécification
| HIV-1 Integrase Protein | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh | |
| Greater than 95.0% as determined by SDS-PAGE. |
| 1 mg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| HIV | |
| His | |
| 1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X and 50% Glycerol. |