missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-1 Integrase Protein

A cDNA sequence encoding the HIV-1 Integrase was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP12252-1mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15929838

  • 1810.00€ / 1mg
Expédition estimée: 30-06-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

HIV-1 Integrase Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HIV
His
1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X and 50% Glycerol.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh
Vidéos
FDS
Documents
Certificats
Promotions

Promotions