missing translation for 'onlineSavingsMsg'
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active) Code produit.: 18735843
  1. Home
  2. Products
  3. Protéines recombinantes
  4. Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Code produit. 18735843 Tous les produits Bio Techne Produits
100 μg, 1 kit
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
100 μg
200 μg
500 μg
Conditionnement:
1 kit
200µg
500µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 18735843

Marque: Novus Biologicals™ NBP254789100UG

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Highly purified and high bioactivity. Generating reliable and reproducible results.

An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.
TRUSTED_SUSTAINABILITY

Spécification

À utiliser avec (application) In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
Formule PBS
Identification génétique (Entrez) 6622
Nom Human alpha-Synuclein Aggregate Protein
Méthode de purification >95% pure by SDS-PAGE
Quantité 100 μg
Source E.Coli
Immunogène MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Conditions de stockage Store at −80°C. Avoid freeze-thaw cycles.
État réglementaire RUO
Alias de gène alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Symbole de gène(s) SNCA
Activité biologique Endogenous alpha-synuclein phosphorylation. 100μM alpha synuclein protein monomer seeded with 10nM alpha synuclein protein aggregate in 25μM Thioflavin T (PBS pH 7.4, 100μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450nm and emission at 485nm on a Molecular Devices Gemini XPS microplate reader.
Type de produit Recombinant Protein
Conjugué Unconjugated
Réactivité croisée Human
Recombinant Recombinant
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active) >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis