missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)
Tous les produits Bio Techne ProduitsCode nomenclature Nacres: NA.28
Click to view available options
Quantité:
100 μg
200 μg
500 μg
Conditionnement:
1 kit
200µg
500µg
Description
An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.

Spécification
Spécification
À utiliser avec (application) | In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot |
Formule | PBS |
Identification génétique (Entrez) | 6622 |
Nom | Human alpha-Synuclein Aggregate Protein |
Méthode de purification | >95% pure by SDS-PAGE |
Quantité | 100 μg |
Source | E.Coli |
Immunogène | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Conditions de stockage | Store at −80°C. Avoid freeze-thaw cycles. |
État réglementaire | RUO |
Afficher plus |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active) >
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu