missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human GMFB Protein

A cDNA sequence encoding the GMFB was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP12004-1mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15919068

  • 7030.00€ / 1mg
Expédition estimée: 04-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

GMFB Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
Untagged
The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl.
Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH
Vidéos
FDS
Documents
Certificats
Promotions

Promotions