Learn More
enQuireBio™ Recombinant Human GMFB Protein
A cDNA sequence encoding the GMFB was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP12004-2ug
Informations supplémentaires : Poids : 0.01000kg
Spécification
GMFB Protein | |
2 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Human | |
Untagged | |
The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl. |
Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH |